PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013597556.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family C3H
Protein Properties Length: 1194aa    MW: 133847 Da    PI: 8.1523
Description C3H family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013597556.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B339.59.8e-13841493399
                     -SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3  33 sktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                     ++ l+++de+g+ We+ +  + + + y lt+GW+++vk+++L +gD+v ++++ +++ +l++++ r+
  XP_013597556.1  84 EMILRVQDEEGKPWEFGF-LDVNIQFYQLTNGWSNYVKEKQLGVGDIVFLQRIFTDSSRLFIGFSRR 149
                     56799*************.79999***************************9988888899998887 PP

2zf-CCCH35.22.1e-119961022127
                      --S---SGGGGTS--TTTTT-SS-SSS CS
         zf-CCCH    1 yktelCrffartGtCkyGdrCkFaHgp 27  
                      +++++C ++++tG Ck+G+ CkF+H++
  XP_013597556.1  996 PGEPECAYYMKTGGCKFGSDCKFHHPR 1022
                      5799*********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.3E-1239149IPR015300DNA-binding pseudobarrel domain
CDDcd100177.44E-745147No hitNo description
SuperFamilySSF1019367.65E-946142IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.002746150IPR003340B3 DNA binding domain
PfamPF023629.7E-1183149IPR003340B3 DNA binding domain
PROSITE profilePS5086310.39187150IPR003340B3 DNA binding domain
SMARTSM002550.0018182320IPR000157Toll/interleukin-1 receptor homology (TIR) domain
PfamPF015822.4E-15185304IPR000157Toll/interleukin-1 receptor homology (TIR) domain
SuperFamilySSF522007.72E-12201295IPR000157Toll/interleukin-1 receptor homology (TIR) domain
Gene3DG3DSA:3.40.50.101408.3E-5232293IPR000157Toll/interleukin-1 receptor homology (TIR) domain
SuperFamilySSF525403.45E-39349592IPR027417P-loop containing nucleoside triphosphate hydrolase
PfamPF009312.3E-20351597IPR002182NB-ARC
Gene3DG3DSA:3.40.50.3002.7E-5364498IPR027417P-loop containing nucleoside triphosphate hydrolase
PRINTSPR003641.2E-22366381No hitNo description
PRINTSPR003641.2E-22442456No hitNo description
PRINTSPR003641.2E-22533547No hitNo description
SuperFamilySSF467859.25E-5569672IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF520581.7E-32695921IPR032675Leucine-rich repeat domain, L domain-like
Gene3DG3DSA:3.80.10.102.8E-26729925IPR032675Leucine-rich repeat domain, L domain-like
PfamPF077256.9E-7758775IPR011713Leucine-rich repeat 3
PRINTSPR003641.2E-22845861No hitNo description
PROSITE profilePS5010314.5029951023IPR000571Zinc finger, CCCH-type
SMARTSM003561.8E-59951022IPR000571Zinc finger, CCCH-type
PfamPF006426.4E-99971022IPR000571Zinc finger, CCCH-type
SuperFamilySSF902291.44E-510001024IPR000571Zinc finger, CCCH-type
Gene3DG3DSA:4.10.1000.109.7E-410011023IPR000571Zinc finger, CCCH-type
PROSITE profilePS5010311.38510391067IPR000571Zinc finger, CCCH-type
SMARTSM003560.6910391066IPR000571Zinc finger, CCCH-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007165Biological Processsignal transduction
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0043531Molecular FunctionADP binding
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 1194 aa     Download sequence    Send to blast
MNSSGSDLFL ASLLLLIERD TIQCSNKSFL IETLSLSTFS EMEILFEKYL TTADLSWLNI  60
FLFGANEEVV EYFGLATVFA RGAEMILRVQ DEEGKPWEFG FLDVNIQFYQ LTNGWSNYVK  120
EKQLGVGDIV FLQRIFTDSS RLFIGFSRRE AALDGTSSDK LKEVNSPLPL RSHVHSVTEF  180
DPVLVFSCAA NQESGERYFI SYISTELCLR GFTPLIYDLT RGTLTGCLEL PHRSRVGIII  240
FSNNYASSRQ CQDNFVAIMD HSKANSLVLL PVFFKVKVTD IRGQSGSFGR AFSQLENSIQ  300
ASQVPTFTFI DKHQYMKGGE VILAKNIVSN VCLLLSSENN MKLRGRLQMN SVLSLLYCSQ  360
SSAPHIVGLW GMAGIGKTTI AREIFRTQAD RYDVCYFLPD FHIACQMRGL SHLRDEFFSK  420
IYGEEKVTVD ACDTKLSFLR DRFLSKKVLV VLDGVSSARD AEFLVGGFGW FSGGHTLILT  480
SRNRQVLIQC TAKEIYEIQK LSEHESLHVC SQFAAVQNWK ERTSLVSELV NYASGIPLAL  540
RALGSSLQNN CIVGEKQHLK TLRQHPLVEI QDAFKRSFDV LDGNEKHIFL DLACFFRGEN  600
KDYVVSILDA CGFFTDLGIY GLIDESLISL VGNRIEMPNI FQDTGRFVVC QENNETGKRS  660
RLLDPTDIVD VLTNNSGTEA IEGIFLDASG LTFELSTTAF EKMYRLRLLK LYCPTSENHC  720
KVSLPQGLYS LPDELRLLHW ERYPLGSLPR NFNPKNIVEL NMPYSNMTRL WKGTKNLERL  780
KRIILSHSRQ LTKFPRLSKA KNLELIDLEG CTSLVKVNSS ILHHQKLTFL SLKDCSRLRS  840
MPATVHLEAL KVLNLSGCSE LEDLQDFSPN LSELYLAGTA ITEIPSSIGG LTRLVTLDLE  900
NCNRLQHLPP EISNLKAVVS LSAKRPASSK ESRDLASFVD VAPPYRRYRL KRCIEAVILS  960
LRKRKREKIF SIATNLSEVM RASVSTWGFF GLPERPGEPE CAYYMKTGGC KFGSDCKFHH  1020
PRHRETHIPG LSSFSHPLRP GNPVCASYYY TGNCSSGATC MFDHPSSIPT HRDTSFVASL  1080
TPNLNPRGFS SSIGDSSSEL VEAATKKRRI HHNTSPMVSE TPLLNLRGFV SSIGDASSKL  1140
VEAPTSKVRI AARKKQRIHK NTTSMASETP HLNPPELSSS PGALSSEHVK QNKD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1961967RKRKREK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ8428070.0FJ842807.1 Brassica rapa subsp. pekinensis isolate BrTNL50 disease resistance protein gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013597556.10.0PREDICTED: probable WRKY transcription factor 19 isoform X2
TrEMBLA0A0D3DF150.0A0A0D3DF15_BRAOL; Uncharacterized protein
STRINGBra012540.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12020.11e-145WRKY family protein